C14-demethylase

Product Name: PrEST Antigen TMEM151B

Synonym: C6orf137; TMEM193; bA444E17.5

Product Type: Chemical

CAS NO: 1431697-84-5Na(addition)_K(addition) ATPase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000178233
Form: buffered aqueous solution
Immunogen sequence: CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8IW70
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human TMEM151B
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA055167.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/341

Product Name: PrEST Antigen B3GNT4

Synonym: B3GN-T4; beta3Gn-T4

Product Type: Chemical

CAS NO: 943134-39-2Monocarboxylate Transporter inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000176383
Form: buffered aqueous solution
Immunogen sequence: TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9C0J1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human B3GNT4
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA055261.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/334

Product Name: PrEST Antigen SUSD5

Synonym: KIAA0527

Product Type: Chemical

CAS NO: 943133-81-1Monoamine Transporter inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000173705
Form: buffered aqueous solution
Immunogen sequence: KHLFWFPAEAFHKPGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGKNDSKAGDPVVS
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O60279
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human SUSD5
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA052788.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/325

Product Name: PrEST Antigen C17orf96

Synonym: LOC100170841

Product Type: Chemical

CAS NO: 56776-32-0HCN Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000273604
Form: buffered aqueous solution
Immunogen sequence: NCFPCPPALVVGEDGDLKPASSLRLQGDSK
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: A6NHQ4
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human C17orf96
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA056555.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/319

Product Name: PrEST Antigen DOK7

Synonym: C4orf25; Dok-7; FLJ33718; FLJ39137

Product Type: Chemical

CAS NO: 143664-11-3GABA Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000175920
Form: buffered aqueous solution
Immunogen sequence: SSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHS
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q18PE1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human DOK7
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA059449.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/314

Product Name: PrEST Antigen EMR1

Synonym: TM7LN3

Product Type: Chemical

CAS NO: 891494-63-6CRM1 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000174837
Form: buffered aqueous solution
Immunogen sequence: MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMAN
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q14246
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human EMR1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA052809.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/310

Product Name: PrEST Antigen OR5P3

Synonym: JCG1

Product Type: Chemical

CAS NO: 891494-64-7Chloride Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000182334
Form: buffered aqueous solution
Immunogen sequence: FCDYSPLLKLACSHDFTFEIIPA
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8WZ94
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human OR5P3
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA060787.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/303

Product Name: PrEST Antigen OR51A7

Product Type: Chemical

CAS NO: 1228690-36-5CFTR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000176895
Form: buffered aqueous solution
Immunogen sequence: CVKTRQIWEKILGKLLNVCGR
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8NH64
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human OR51A7
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA061356.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/295

Product Name: PrEST Antigen RPLP2

Synonym: D11S2243E; LP2; MGC71408; P2; RPP2

Product Type: Chemical

CAS NO: 1431697-89-0BCRP inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000177600
Form: buffered aqueous solution
Immunogen sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVIS
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P05387
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human RPLP2
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA053635.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/289

Product Name: PrEST Antigen ATP6V1E2

Synonym: ATP6E1; ATP6EL2; ATP6V1EL2; MGC9341; VMA4

Product Type: Chemical

CAS NO: 355406-09-6ATP Synthase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000250565
Form: buffered aqueous solution
Immunogen sequence: YMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKV
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96A05
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human ATP6V1E2
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA052784.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/290/1/281