C14-demethylase

Product Name: PrEST Antigen PATZ1

Synonym: MAZR; PATZ; RIAZ; ZBTB19; dJ400N23

Product Type: Chemical

CAS NO: 61-12-1Acids and Aldehydes inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000100105
Form: buffered aqueous solution
Immunogen sequence: LLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEI
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9HBE1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human PATZ1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA047893.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1113

Product Name: PrEST Antigen EHD3

Synonym: PAST3

Product Type: Chemical

CAS NO: 554-57-4Alkaloid inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000013016
Form: buffered aqueous solution
Immunogen sequence: PDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKE
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9NZN3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human EHD3
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA049986.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1104

Product Name: PrEST Antigen RPS17

Synonym: MGC72007; RPS17L1; RPS17L2; S17

Product Type: Chemical

CAS NO: 112111-44-1Terpenoids and Glycosides inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000182774
Form: buffered aqueous solution
Immunogen sequence: RGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKL
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human RPS17
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA055060.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1096

Product Name: PrEST Antigen LY6G5B

Synonym: C6orf19; G5b

Product Type: Chemical

CAS NO: 939791-38-5Quinones inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000240053
Form: buffered aqueous solution
Immunogen sequence: CCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQ
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8NDX9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human LY6G5B
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA048307.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1084

Product Name: PrEST Antigen NUP50

Synonym: NPAP60L

Product Type: Chemical

CAS NO: 7177-50-6Saccharides and Glycosides inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000093000
Form: buffered aqueous solution
Immunogen sequence: DSQQPSSSGLASSKACVGNAYHKQLAALDCSVRD
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9UKX7
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human NUP50
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA047162.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1073

Product Name: PrEST Antigen TNFRSF6B

Synonym: DcR3; M68; TR6

Product Type: Chemical

CAS NO: 603-50-9Cell_Counting_Kit-8 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000243509
Form: buffered aqueous solution
Immunogen sequence: RDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFFAHAGFCLEHASCPPG
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human TNFRSF6B
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA047154.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1068

Product Name: PrEST Antigen KIAA1210

Product Type: Chemical

CAS NO: 42924-53-8Phosphatase_Inhibitor_Cocktail_I inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000250423
Form: buffered aqueous solution
Immunogen sequence: NLVEISLDDESPKNPQKKALPHKSLTATQSFSELSSGPDCSQSLTAFATLASTSSTQLPIGFSTPATTQGCLDSSAARHKMTLNPRKQKKN
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9ULL0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human KIAA1210
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA048322.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1061

Product Name: PrEST Antigen NOTCH2

Product Type: Chemical

CAS NO: 132112-35-7Protease_Inhibitor_Cocktail inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000134250
Form: buffered aqueous solution
Immunogen sequence: TCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSR
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q04721
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human NOTCH2
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA046392.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1051

Product Name: PrEST Antigen SRSF2

Synonym: PR264; SC-35; SC35; SFRS2; SFRS2A

Product Type: Chemical

CAS NO: 7681-76-7Wnt/Hedgehog/Notch_Compound_Library inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000161547
Form: buffered aqueous solution
Immunogen sequence: LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human SRSF2
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA049905.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1039

Product Name: PrEST Antigen ST8SIA5

Synonym: SIAT8E

Product Type: Chemical

CAS NO: 522-51-0Smad_Compound_Library inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000101638
Form: buffered aqueous solution
Immunogen sequence: SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O15466
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human ST8SIA5
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA046771.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/3/1031