C14-demethylase

Product Name: PrEST Antigen BRPF1

Synonym: BR140

Product Type: Chemical

CAS NO: 87679-37-6Aldehyde Dehydrogenase (ALDH) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000156983
Form: buffered aqueous solution
Immunogen sequence: SLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTD
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P55201
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human BRPF1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA003359.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/335

Product Name: PrEST Antigen FOXN2

Synonym: HTLF

Product Type: Chemical

CAS NO: 66108-95-0Adenosine Deaminase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000170802
Form: buffered aqueous solution
Immunogen sequence: LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA
Mol wt: predicted mol wt 33 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P32314
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human FOXN2
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA003485.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/325

Product Name: PrEST Antigen ATF7

Synonym: ATFA

Product Type: Chemical

CAS NO: 132907-72-35 alpha Reductase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000170653
Form: buffered aqueous solution
Immunogen sequence: LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE
Mol wt: predicted mol wt 32 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P17544
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human ATF7
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA003384.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/317

Product Name: PrEST Antigen NPAS2

Synonym: MOP4; PASD4; bHLHe9

Product Type: Chemical

CAS NO: 89365-50-4Metabolic Enzyme_Protease inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000170485
Form: buffered aqueous solution
Immunogen sequence: SKPEFIVCTHSVVSYADVRVERRQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLMAEASTPALPRSATLPQELPVP
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q99743
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human NPAS2
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA019674.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/307

Product Name: PrEST Antigen ONECUT1

Synonym: HNF-6; HNF6; HNF6A

Product Type: Chemical

CAS NO: 209860-87-7URAT1 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000169856
Form: buffered aqueous solution
Immunogen sequence: SMNNLYTPYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEV
Mol wt: predicted mol wt 32 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9UBC0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human ONECUT1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA003457.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/299

Product Name: PrEST Antigen ZEB2

Synonym: KIAA0569; SIP-1; SIP1; ZFHX1B

Product Type: Chemical

CAS NO: 103-90-2Sodium Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000169554
Form: buffered aqueous solution
Immunogen sequence: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Mol wt: predicted mol wt 31 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O60315
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human ZEB2
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA003456.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/293

Product Name: PrEST Antigen ATF5

Product Type: Chemical

CAS NO: 594839-88-0Proton Pump inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000169136
Form: buffered aqueous solution
Immunogen sequence: PLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDL
Mol wt: predicted mol wt 31 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9Y2D1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human ATF5
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA030187.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/285

Product Name: PrEST Antigen SF1

Synonym: ZFM1; ZNF162

Product Type: Chemical

CAS NO: 56420-45-2P2X Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000168066
Form: buffered aqueous solution
Immunogen sequence: NQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLI
Mol wt: predicted mol wt 33 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q15637
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human SF1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA018883.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/28

Product Name: PrEST Antigen ZNF146

Synonym: OZF

Product Type: Chemical

CAS NO: 18472-51-0NKCC inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000167635
Form: buffered aqueous solution
Immunogen sequence: LSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIR
Mol wt: predicted mol wt 31 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q15072
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human ZNF146
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA003358.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/277

Product Name: PrEST Antigen SP2

Synonym: KIAA0048

Product Type: Chemical

CAS NO: 202189-78-4Na(addition)_K(addition) ATPase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000167182
Form: buffered aqueous solution
Immunogen sequence: KLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPIKPAPIQKSST
Mol wt: predicted mol wt 31 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q02086
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human SP2
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA003357.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/285/1/271