C14-demethylase

Product Name: PrEST Antigen OCEL1

Synonym: FLJ22709

Product Type: Chemical

CAS NO: 1446486-33-415-PGDH inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000099330
Form: buffered aqueous solution
Immunogen sequence: HKAKTKKIVFEDELLSQALLGAKKPIGAIPKGHKPRPHPVPDYELKYPPVSSERERSRYVAVFQDQYGEFLELQH
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9H607
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human OCEL1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA042070.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/265

Product Name: PrEST Antigen GMIP

Synonym: ARHGAP46

Product Type: Chemical

CAS NO: 1857417-13-0VDAC inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000089639
Form: buffered aqueous solution
Immunogen sequence: AQLVEFLIVHYEQIFGMDELPQATEPPPQDSSPAPGPLTTSSQPPPPHLDPDSQPPVLASDPGPDPQHHSTLEQHPTATPTEIPTPQ
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9P107
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human GMIP
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA045481.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/258

Product Name: PrEST Antigen HNRNPL

Synonym: HNRPL

Product Type: Chemical

CAS NO: TRP Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000104824
Form: buffered aqueous solution
Immunogen sequence: YKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMK
Mol wt: predicted mol wt 29 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P14866
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human HNRNPL
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA051748.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/253

Product Name: PrEST Antigen BLVRB

Synonym: FLR; SDR43U1

Product Type: Chemical

CAS NO: 1233855-46-3SGLT inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000090013
Form: buffered aqueous solution
Immunogen sequence: HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P30043
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human BLVRB
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA041698.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/246

Product Name: PrEST Antigen STRN4

Synonym: ZIN; zinedin

Product Type: Chemical

CAS NO: 529-44-2Potassium Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000090372
Form: buffered aqueous solution
Immunogen sequence: LCTFPTASEHGVPTSVAFTSTEPAHIVASFRSGDTVLYDMEVGSALLTLESRGSSGPTQINQVVSHPNQPLTITAHDDRGIRFLD
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9NRL3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human STRN4
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA043527.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/238

Product Name: PrEST Antigen SULT2B1

Synonym: HSST2

Product Type: Chemical

CAS NO: 692737-80-7P-glycoprotein inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000088002
Form: buffered aqueous solution
Immunogen sequence: HIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRR
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O00204
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human SULT2B1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA041724.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/231

Product Name: PrEST Antigen DHDH

Synonym: HUM2DD

Product Type: Chemical

CAS NO: 9012-76-4nAChR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000104808
Form: buffered aqueous solution
Immunogen sequence: LISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPT
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9UQ10
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human DHDH
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA044131.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/223

Product Name: PrEST Antigen GYS1

Synonym: GSY; GYS

Product Type: Chemical

CAS NO: Na(addition)_HCO3- Cotransporter inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000104812
Form: buffered aqueous solution
Immunogen sequence: PSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSE
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P13807
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human GYS1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA041598.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/219

Product Name: PrEST Antigen RNF126

Synonym: FLJ20552

Product Type: Chemical

CAS NO: 114899-80-8Monocarboxylate Transporter inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000070423
Form: buffered aqueous solution
Immunogen sequence: PEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRD
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9BV68
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human RNF126
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA043050.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/212

Product Name: PrEST Antigen WDR18

Synonym: Ipi3

Product Type: Chemical

CAS NO: 9004-61-9iGluR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000065268
Form: buffered aqueous solution
Immunogen sequence: AEHHMFCGGSEGSIFQVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQSKQCIR
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9BV38
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human WDR18
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA050200.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/276/1/21