Product Name: Anti-ACAT1 antibody produced in rabbit

Synonym: Anti-ACAT; Anti-Acetyl-coenzyme A acetyltransferase 1 (acetoacetyl coenzyme A thiolase); Anti-MAT; Anti-T2; Anti-THIL

Product Type: Chemical

CAS NO: 1271738-62-5GPCR19 inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 41 kDa
NCBI accession no.
NP_000010
Shipped in: wet ice
species reactivity
horse, rat, guinea pig, bovine, zebrafish, mouse, human, rabbit
Storage temp.: −20°C
Application: Anti-ACAT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
ACAT1 gene encodes a mitochondrial enzyme that catalyzes the reversible Formation of acetoacetyl-CoA from two molecules of acetyl-CoA. It also facilitates the lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it also catalyzes the esterification of 24(S)-hydroxycholesterol (24S-OHC), which results in lipid droplet Formation and induces 24S-OHC-mediated apoptosis. Furthermore, ACAT1 expression also serves as a potent prognostic marker for prostate cancer.
Immunogen:
The immunogen for anti-ACAT1 antibody: synthetic peptide derected towards the middle region of human ACAT1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/46/4/387

Related Post