Product Name: Anti-AKT1 antibody produced in rabbit

Synonym: Anti-v-akt murine thymoma viral oncogene homolog 1

Product Type: Chemical

CAS NO: 1622849-58-4ROCK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 56 kDa
NCBI accession no.
NP_005154
Shipped in: wet ice
species reactivity
human, mouse, goat, sheep, canine, bovine, rat, pig
Storage temp.: −20°C
Application: Anti-AKT1 antibody is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions:
Although upregulation of Akt1 activity is rarely reported in cancers, mutations in Akt1 gene have been identified in many malignancies. Akt1 regulates homologous recombination and maintains genetic stability in breast cancer cells.
General description: Akt kinases participate in multiple signal transduction pathways and important cellular processes such as proliferation, survival, migration and angiogenesis.
Immunogen:
The immunogen for anti-AKT1 antibody: synthetic peptide derected towards the N terminal of human AKT1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/1

Related Post