Product Name: Anti-ARG2 antibody produced in rabbit

Synonym: Anti-Arginase, type II

Product Type: Chemical

CAS NO: 208260-29-1DNA Stain inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Conjugate: unconjugated
Form: lyophilized powder
Immunogen sequence: LLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQL
Mol wt: mol wt 39 kDa
NCBI accession no.
NP_001163
species reactivity
human, horse, rabbit, bovine, canine, rat, mouse, rabbit
Storage temp.: −20°C
Application: Anti-ARG2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
Arginase II catalyzes the hydrolysis of arginine to ornithine and urea. It may play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. It is expressed most strongly in kidney and prostate. Extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase in human penile corpus cavernosum smooth muscle. NO synthase is also found in clitoral corpus cavernosum and the vagina. Studies suggest that arginase II plays a role in both male and female sexual arousal. It is, therefore, a potential target for the treatment of male and female sexual arousal disorders.
Immunogen:
synthetic peptide corresponding to a region of human ARG2 with an internal ID of P31351
Physical Form: Lyophilized from PBS buffer with 2% sucrose
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/48/2/149

Related Post