Product Name: Anti-ASPH antibody produced in rabbit

Synonym: Anti-Aspartate β-hydroxylase; Anti-BAH; Anti-CASQ2BP1; Anti-HAAH; Anti-JCTN; Anti-Junctin

Product Type: Chemical

CAS NO: 95635-56-6Cytoskeleton inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 25 kDa
NCBI accession no.
NP_115856
species reactivity
bovine, canine, human, mouse, horse, rat
Storage temp.: −20°C
Application: Anti-ASPH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
Aspartate beta-hydroxylase (ASPH; Junctin) is a Ca+2-cycling protein that regulates the amount of Ca+2 in stored and released by the sarcoplasmic reticulum. In collaboration with another protein called Triadin, ASPH controls the contractile properties of heart during the excitation-contraction coupling.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-ASPH antibody: synthetic peptide derected towards the N terminal of human ASPH
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/40/2/215

Related Post