Product Name: Anti-C20ORF10 antibody produced in rabbit

Synonym: Anti-CLG01; Anti-TP53TG5

Product Type: Chemical

CAS NO: 1315355-93-1Autophagy inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 32 kDa
NCBI accession no.
NP_055292
Shipped in: wet ice
species reactivity
canine, mouse, guinea pig, human, rat, rabbit
Storage temp.: −20°C
Application: Anti-C20ORF10 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
C20ORF10 (chromosome 20 open reading frame 10) encodes a protein that is expressed predominantly in heart, brain and small intestine and at lower levels in skeletal muscle, spleen, prostate, ovary and colon. It plays a pivotal role in p53/TP53-mediating signaling pathway and inhibits the cell growth.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-C20ORF10 antibody: synthetic peptide derected towards the N terminal of human C20ORF10
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/45/2/163

Related Post