Product Name: Anti-C20ORF3 (AB1) antibody produced in rabbit

Synonym: Anti-APMAP; Anti-BSCv

Product Type: Chemical

CAS NO: 1415800-43-9Eukaryotic Initiation Factor (eIF) inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 46 kDa
NCBI accession no.
NP_065392
Shipped in: wet ice
species reactivity
zebrafish, mouse, guinea pig, horse, bovine, rat, human, rabbit, canine
Storage temp.: −20°C
Application: Anti-C20ORF3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions:
Adipocyte plasma membrane associated protein (APMAP; C20ORF3) is involved in the interaction of mature adipocytes with the environment during differentiation. C20ORF3 is associated with metastatic colorectal cancer. C20ORF3 interacts with γ-secretase and amyloid precursor protein, and thereby suppresses the amyloid-β (Aβ) production in the brain.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: Adipocyte plasma membrane associated protein (APMAP; C20ORF3) is a member of the lactonohydrolase super family. The gene is mapped to human chromosome 20p11. C20ORF3 is highly expressed in human liver, placenta and kidney. C20ORF3 is popularly referred as APMAP.
Immunogen:
The immunogen for anti-C20ORF3 antibody: synthetic peptide derected towards the N terminal of human C20ORF3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/361/1/115

Related Post