Anti-C3ORF31 antibody produced in rabbit

Product Name: Anti-C3ORF31 antibody produced in rabbit

Synonym: Anti-DKFZp434E0519; Anti-MGC16471

Product Type: Chemical

CAS NO: 901119-35-5Protease-Activated Receptor (PAR) inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 36 kDa
NCBI accession no.
NP_620162
Shipped in: wet ice
species reactivity
bovine, horse, guinea pig, human, rabbit
Storage temp.: −20°C
Application: Rabbit Anti-C3ORF31 antibody is suitable for western blot applications at a concentration of 2.5μg/ml and for IHC using paraffin-embedded tissue at 4-8μg/ml.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: C3ORF31 (TAMM41 or TAM41) codes for a mitochondrial translocator assembly and maintenance protein.
Rabbit Anti-C3ORF31 antibody recognizes bovine and human C3ORF31.
Immunogen:
The immunogen for anti-C3ORF31 antibody: synthetic peptide derected towards the N terminal of human C3ORF31
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/357/2/264