Anti-CALR (AB1) antibody produced in rabbit

Product Name: Anti-CALR (AB1) antibody produced in rabbit

Synonym: Anti-Calreticulin

Product Type: Chemical

CAS NO: 179461-52-0Metabolism/Protease_Compound_Library inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 48 kDa
NCBI accession no.
NP_004334
Shipped in: wet ice
species reactivity
human, pig, goat, guinea pig, horse, rat, mouse, canine, rabbit, zebrafish
Storage temp.: −20°C
Application: Rabbit Anti-CALR (AB1) antibody can be used for western blot (1.0μg/ml) applications.
General description: Calreticulin (CALR) is a calcium-binding protein that can regulate nuclear hormone receptor-mediated gene transcription. CALR is also involved in integrin-mediated calcium signaling pathways and cell adhesion.
Rabbit Anti-CALR antibody recognizes human, mouse, rat, canine, rabbit, and pig calreticulin.
Immunogen:
The immunogen for anti-CALR antibody: synthetic peptide derected towards the C terminal of human CALR
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: FGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDK
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/699