Anti-CCNA2 antibody produced in rabbit

Product Name: Anti-CCNA2 antibody produced in rabbit

Synonym: Anti-Cyclin A2

Product Type: Chemical

CAS NO: 1243245-18-2LIM Kinase (LIMK) inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 49 kDa
NCBI accession no.
NP_001228
Shipped in: wet ice
species reactivity
bovine, pig, rabbit, canine, human, zebrafish, mouse, rat, horse
Storage temp.: −20°C
Application: Anti-CCNA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
Cyclin A2 is an A-type cyclin expressed in mitotically dividing cells and overexpressed in many types of cancer. It is a critical regulator of progression of cell cycle from S phase to the mitosis. Cyclin A2 prevents the epithelial to mesenchymal transition by regulating the actin cytoskeleton and cell invasion in collaboration with RhoA.
General description: Cyclins are key regulatory proteins that control cell cycle progression by phosphorylating cyclin-dependent kinases.
Immunogen:
The immunogen for anti-CCNA2 antibody: synthetic peptide derected towards the C terminal of human CCNA2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/926