Anti-CCNG2 antibody produced in rabbit

Product Name: Anti-CCNG2 antibody produced in rabbit

Synonym: Anti-Cyclin G2

Product Type: Chemical

CAS NO: 36098-33-6HDAC inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 39 kDa
NCBI accession no.
NP_004345
Shipped in: wet ice
species reactivity
canine, human, bovine, rat, mouse
Storage temp.: −20°C
Application: Anti-CCNG2 antibody is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions:
Cyclin G2 is an unconventional cyclin protein that shuttles between nucleus and cytoplasm and is linked to growth inhibition and cell differentiation. Overexpression of CyclinG2 results in p53-dependent arrest of cell cycle in G1/S phase. It enforces G2/M cell cycle arrest in collaboration with DNA damage checkpoint signaling.
Immunogen:
The immunogen for anti-CCNG2 antibody: synthetic peptide derected towards the N terminal of human CCNG2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/891