Product Name: Anti-CD36 antibody produced in rabbit

Synonym: Anti-CD36 molecule (thrombospondin receptor); Anti-CHDS7; Anti-FAT; Anti-GP3B; Anti-GP4; Anti-GPIV; Anti-PASIV; Anti-SCARB3

Product Type: Chemical

CAS NO: 1197300-24-5HDAC inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Mol wt: mol wt 53 kDa
NCBI accession no.
NP_000063
Shipped in: wet ice
species reactivity
horse, rabbit, bovine, rabbit, canine, human, pig, rat
Storage temp.: −20°C
Application: Rabbit Anti-CD36 antibody is suitable for western blot applications at a concentration of 1 μg/ml and for immunohistochemistry applications at a concentration of 4-8 μg/ml.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: CD36 is a glycoprotein that functions as a receptor for thrombospondin in platelets. Studies have reported that TLR4 signaling inhibited the expression of CD36 and subsequently slowed hematoma absorption. CD36 mediates NLRP3 inflammasome stimulation during inflammation.
Rabbit Anti-CD36 antibody recognizes bovine, rabbit, canine, human, pig, and rat CD36.
Immunogen:
The immunogen for anti-CD36 antibody: synthetic peptide derected towards the N terminal of human CD36
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/358/1/125

Related Post