Product Name: Anti-CDK2 (AB2) antibody produced in rabbit

Product Type: Chemical

CAS NO: 300817-68-9DNA-PK inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 34 kDa
NCBI accession no.
NP_439892
Shipped in: wet ice
species reactivity
human, zebrafish, mouse, rat, sheep, bovine, guinea pig, goat, rabbit
Storage temp.: −20°C
Application: Anti-CDK2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
Cyclin-dependent kinase 2 has a unique role in suppressing cell senescence and apoptosis induced by Myc. It is redundant for cell cycle progression but is activated following Myc overexpression to prevent Myc-induced senescence-like arrest. CDK2 functions in association with cyclin E and regulates meiosis at prophase I.
Immunogen:
The immunogen for anti-CDK2 antibody: synthetic peptide derected towards the C terminal of human CDK2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/846