Anti-CDK4 (AB2) antibody produced in rabbit

Product Name: Anti-CDK4 (AB2) antibody produced in rabbit

Synonym: Anti-Cyclin-dependent kinase 4

MDL Number: MFCD00282839
Product Type: Chemical

CAS NO: 220355-63-5Eukaryotic Initiation Factor (eIF) inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 34 kDa
NCBI accession no.
NP_000066
Shipped in: wet ice
species reactivity
rabbit, pig, human, canine, rat
Storage temp.: −20°C
Application: Anti-CDK4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
CDK4 Forms a complex with cyclin D1 and regulates cell proliferation during the G1 phase. It also binds with human p16 and inhibits the activity of the CDK4/cyclin D complex in cells that lack retinoblastoma protein. CDK4 Forms a complex with pRB and E2F1 proteins that modulate the secretion of insulin by pancreatic β-cells.
Immunogen:
The immunogen for anti-CDK4 antibody: synthetic peptide derected towards the C terminal of human CDK4
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/863