Anti-CDK6 antibody produced in rabbit

Product Name: Anti-CDK6 antibody produced in rabbit

Synonym: Anti-Cyclin-dependent kinase 6; Anti-MGC59692; Anti-PLSTIRE

Product Type: Chemical

CAS NO: 370-86-5DNA Stain inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 37 kDa
NCBI accession no.
NP_001250
Shipped in: wet ice
species reactivity
horse, bovine, canine, rabbit, mouse, pig, human
Storage temp.: −20°C
Antigen Background:
CDK6 is a cyclin-dependent kinase important in regulating cell cycle progression specifically transitioning from G1 to G1/S phase.
Application: Anti-CDK6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.625 μg/ml.
Biochem/physiol Actions:
CDK6 is a D-type cyclin dependent kinase that initiates the phosphorylation of Rb tumor suppressor protein. In selected cell types the cyclin D/CDK6 activity is essential for cell proliferation. In collaboration with pRb, CDK6 has been discovered to play an important role in cell differentiation and in maintaining the cell cycle exit during differentiation.
Immunogen:
The immunogen for anti-CDK6 antibody: synthetic peptide derected towards the C terminal of human CDK6
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/840