Anti-CHML antibody produced in rabbit

Product Name: Anti-CHML antibody produced in rabbit

Synonym: Anti-Choroideremia-like (Rab escort protein 2)

Product Type: Chemical

CAS NO: 2883-98-9SGK inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 74 kDa
NCBI accession no.
NP_001812
Shipped in: wet ice
species reactivity
human
Storage temp.: −20°C
Application: Anti-CHML antibody produced in rabbit is suitable for western blotting at a concentration of 0.05 μg/ml.
Biochem/physiol Actions:
CHML (Rab escort protein 2) binds to newly synthesized Rab proteins and mediates geranylgeranylation of most Rab proteins. It may substitute for the absent function of REP1 protein in non-retinal cells and prevent the cellular dysfunction in patients with choroideremia.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-CHML antibody: synthetic peptide derected towards the N terminal of human CHML
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: NPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/141