Product Name: Anti-CHRNA7 (AB2) antibody produced in rabbit

Synonym: Anti-Cholinergic receptor, nicotinic, α 7

Product Type: Chemical

CAS NO: 115103-85-0Tryptophan Hydroxylase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 56 kDa
NCBI accession no.
NP_000737
species reactivity
bovine, mouse, rat, human
Storage temp.: −20°C
Application: Anti-CHRNA7 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions:
CHRNA7 is a transmembrane, oligomeric, ligand-gated nicotinic receptor which upon activation by cholinergic binding induces ion channel opening for the movement of positive ions. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. CHRNA7 has a role in the release of dopamine from striatum and prefrontal cortex in rats indicating a role in the progression of Parkinson′s disease and schizophrenia.
Immunogen:
The immunogen for anti-CHRNA7 antibody: synthetic peptide derected towards the N terminal of human CHRNA7
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/159