Product Name: Anti-CHST13 (AB1) antibody produced in rabbit

Synonym: Anti-C4ST3; Anti-Carbohydrate (chondroitin 4) sulfotransferase 13; Anti-MGC119278; Anti-MGC119279; Anti-MGC119281

Product Type: Chemical

CAS NO: 382-45-6Wnt inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 39 kDa
NCBI accession no.
NP_690849
Shipped in: wet ice
species reactivity
bovine, human
Storage temp.: −20°C
Application: Anti-CHST13 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions:
Carbohydrate (chondroitin 4) sulfotransferase 13 (CHST13; C4ST3) belongs to the sulfotransferase 2 family and is localized to the Golgi membrane. It catalyzes the transfer of sulfate to glucuronic acid residue in chondroitin, a proteoglycan present in the cartilage.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-CHST13 antibody: synthetic peptide derected towards the N terminal of human CHST13
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/36/4/629

Related Post