Product Name: Anti-CREB3L1 (AB1) antibody produced in rabbit

Synonym: Anti-cAMP responsive element binding protein 3-like 1

Product Type: Chemical

CAS NO: 125314-13-8Others inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 57 kDa
NCBI accession no.
NP_443086
Shipped in: wet ice
species reactivity
mouse, horse, human, canine, guinea pig, rabbit, bovine, rat
Storage temp.: −20°C
Biochem/physiol Actions:
CREB3L1 is localized to the membrane of endoplasmic reticulum that translocates to the nucleus and acts as transcription factor in the event of cellular stress. It regulates the transcription of arginine vasopressin, a neurohypophysical hormone that maintains hydromineral homeostasis. It reportedly represses the expression of genes involved in metastasis, invasion and angiogenesis and thus suppresses tumorigenesis.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-CREB3L1 antibody: synthetic peptide derected towards the N terminal of human CREB3L1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/337/2/547

Related Post