Anti-CREB5 antibody produced in rabbit

Product Name: Anti-CREB5 antibody produced in rabbit

Synonym: Anti-cAMP responsive element binding protein 5

Product Type: Chemical

CAS NO: 121521-90-2Interleukin Related inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 53 kDa
NCBI accession no.
NP_878901
Shipped in: wet ice
species reactivity
rat, human, pig, guinea pig, canine, rabbit, mouse, horse
Storage temp.: −20°C
Application: Anti-CREB5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions:
CREB5 is a transcription factor, overexpressed in frontal cortex of HIV encephalitis patients. It is involved in critical biological processes of nucleic acid metabolism. It also regulates mRNA transcription and intracellular signaling cascades.
Immunogen:
The immunogen for anti-CREB5 antibody: synthetic peptide derected towards the N terminal of human CREB5
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: CSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNV
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/435