Anti-CSDA (AB1) antibody produced in rabbit

Product Name: Anti-CSDA (AB1) antibody produced in rabbit

Synonym: Anti-Cold shock domain protein A

Product Type: Chemical

CAS NO: 870281-34-8Farnesyl Transferase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 40 kDa
NCBI accession no.
NP_003642
Shipped in: wet ice
species reactivity
guinea pig, mouse, human, pig, canine, bovine, rat
Storage temp.: −20°C
Application: Anti-CSDA (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
CSDA is a member of RNA-and DNA-binding cold-shock-domain (CSD) family that regulates EGR1 concentration to mediate luteinizing hormone β subunit transcription. It regulates Bcr-Abl effector, and also regulates cell proliferation and transFormation in chronic myeloid leukemia.
Immunogen:
The immunogen for anti-CSDA antibody: synthetic peptide derected towards the N terminal of human CSDA
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/839