Product Name: Anti-CUL1 antibody produced in rabbit

Synonym: Anti-Cullin 1

MDL Number: MFCD02096156
Product Type: Chemical

CAS NO: 945531-77-1Nucleoside Antimetabolite_Analog inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 90 kDa
NCBI accession no.
NP_003583
Shipped in: wet ice
species reactivity
bovine, zebrafish, mouse, canine, rat, human
Storage temp.: −20°C
Application: Anti-CUL1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions:
Cullin1, a cullin-based ubiquitin ligase, is a scaffold protein that has important role in embryonic development. It promotes the invasion of human trophoblast progenitor cells by increasing the expression of MMP-9 and decreasing TIMP-1 and TIMP-2. In collaboration with Rictor protein, CUL1 promotes the ubiquitination of SGK1 that is important in maintaining cell homeostasis.
Immunogen:
The immunogen for anti-CUL1 antibody: synthetic peptide derected towards the C terminal of human CUL1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/941