Anti-CXCL14 antibody produced in rabbit

Product Name: Anti-CXCL14 antibody produced in rabbit

Synonym: Anti-Chemokine (C-X-C motif) ligand 14

Product Type: Chemical

CAS NO: 166518-60-1SRPK inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 13 kDa
NCBI accession no.
NP_004878
Shipped in: wet ice
species reactivity
guinea pig, horse, bovine, canine, rat
Storage temp.: −20°C
Application: Anti-CXCL14 antibody produced in rabbit is suitable for western blotting at a concentration of 5 μg/ml.
Biochem/physiol Actions:
CXCL14 is a CXC chemokine that is constitutively expressed in brain and other tissues but is downregulated in some Forms of cancer. It inhibits the infiltration of macrophages into white adipose tissue, inhibits angiogenesis and regulates the synaptic inputs to adult neural stem cells. CXCL14 is elevated in colorectal carcinoma and may be a potential prognostic factor to predict recurrence.
Immunogen:
The immunogen for anti-CXCL14 antibody: synthetic peptide derected towards the middle region of human CXCL14
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/107