Anti-CXCL3 antibody produced in rabbit

Product Name: Anti-CXCL3 antibody produced in rabbit

Product Type: Chemical

CAS NO: 480-44-4Dynamin inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 11 kDa
NCBI accession no.
NP_002081
Shipped in: wet ice
species reactivity
human
Storage temp.: −20°C
Antigen Background:
CXCL3 is a chemokine that affects migration and adhesion of monocytes. CXCR2 is its known receptor.
Application: Anti-CXCL3 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
CXCL3 is a chemokine that binds to CXCR1 and CXCR2 receptors and stimulates p38 and ERK1/2-dependent migration of asthmatic airway smooth muscle cells. Prostate stromal cells secrete CXCL3 in response to IL-1 that results in prostatic inflammation in early stages of prostate cancer Formation.
Immunogen:
The immunogen for anti-CXCL3 antibody: synthetic peptide derected towards the middle region of human CXCL3
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/131