Product Name: Anti-DDX5 (AB1) antibody produced in rabbit

Synonym: Anti-DEAD (Asp-Glu-Ala-Asp) box polypeptide 5

Product Type: Chemical

CAS NO: 1675201-83-8Motilin Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 68 kDa
NCBI accession no.
NP_004387
Shipped in: wet ice
species reactivity
rabbit, mouse, rat, bovine, human, canine, horse, guinea pig
Storage temp.: −20°C
Application: Anti-DDX5 (AB1) antibody produced in rabbit is suitable for western blot applications.
Biochem/physiol Actions:
DEAD (Asp-Glu-Ala-Asp) box helicase 5 (DDX5) is a member of putative RNA helicases called the DEAD box proteins. It is involved in regulation of RNA secondary structure during translation initiation, nuclear and mitochondrial splicing and ribosome and spliceosome assembly. DDX5 is a RNA-dependent ATPase and a proliferation-associated nuclear antigen that is a master regulator of estrogen- and androgen-mediated signaling pathways.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: DDX5 (DEAD, Asp-Glu-Ala-Asp, box helicase 5) is a multifunctional protein belonging to the DEAD box family of RNA helicases. It consists of twelve conserved motifs (including the signature D-E-A-D motif) Forming a conserved ′helicase′ central domain, which plays an important role in the RNA metabolism. 2
Immunogen:
The immunogen for anti-DDX5 antibody: synthetic peptide derected towards the C terminal of human DDX5
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/338/1/195

Related Post