Product Name: Anti-DFFA antibody produced in rabbit

Synonym: Anti-DFF-45; Anti-DFF1; Anti-DNA fragmentation factor, 45 kDa, α polypeptide; Anti-ICAD

Product Type: Chemical

CAS NO: 62284-79-1Protease_Inhibitor_Cocktail inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 37 kDa
NCBI accession no.
NP_998731
Shipped in: wet ice
species reactivity
bovine, human, canine, horse, mouse, rat, guinea pig
Storage temp.: −20°C
Application: Anti-DFFA antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions:
DFFA (DNA fragmentation factor, α polypeptide) functions as a chaperone of DNA fragmentation factor 40 (DFF40) in apoptosis and balancing genomic stability. The activity of DFF is induced by cleavage of DFFA by caspase-3, resulting in release of DFF40, which degrades chromosomal DNA. During menstruation, the apoptosis of endometrium cells is associated with DFFA activation. DFFA expression decreases after menopause. DFFA is a target of miR-145.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: DFFA (DNA fragmentation factor, α polypeptide) is a heterodimeric 45kDa protein mapped on chromosome location 1p36.2-36.3. It is localized to the chromatin fraction under both the conditions, apoptotic and non-apoptotic state. Its expression also has been found in neuroblastoma (NB) cell lines.
Immunogen:
The immunogen for anti-DFFA antibody: synthetic peptide derected towards the N terminal of human DFFA
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDIL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/791

Related Post