Product Name: Anti-DIDO1 (AB2) antibody produced in rabbit

Synonym: Anti-Death inducer-obliterator 1

Product Type: Chemical

CAS NO: 1415716-58-3Monoamine Oxidase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 61 kDa
NCBI accession no.
NP_071388
Shipped in: wet ice
species reactivity
rabbit, bovine, mouse, rat, horse, canine, guinea pig, human
Storage temp.: −20°C
Application: Rabbit Anti-DIDO1 (AB2) antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: Death inducer-obliterator 1 (DIDO1) is known to be a BMP-target gene and is involved in melanoma progression. It has also been implicated in colorectal carcinogenesis.
Rabbit Anti-DIDO1 antibody recognizes chicken, bovine, human, mouse, rat, and canine DIDO1.
Immunogen:
The immunogen for anti-DIDO1 antibody: synthetic peptide derected towards the N terminal of human DIDO1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MDDKGDPSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDAEADPLEP
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/342/2/568

Related Post