Anti-DMRT1 antibody produced in rabbit

Product Name: Anti-DMRT1 antibody produced in rabbit

Synonym: Anti-DMT1; Anti-Doublesex and mab-3 related transcription factor 1

Product Type: Chemical

CAS NO: 168425-64-7COX inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 39 kDa
NCBI accession no.
NP_068770
Shipped in: wet ice
species reactivity
canine, human, pig, bovine, rabbit
Storage temp.: −20°C
Application: Anti-DMRT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
DMRT1 protein is involved in sex determination, pluripotency and meiosis. Depletion of both DMRT1 and p53 in spermatogonial stem cells induces pluripotency by upregulation of Sox2. Deficiency of DMRT1 results in apoptosis of germline stem cells.
Immunogen:
The immunogen for anti-DMRT1 antibody: synthetic peptide derected towards the N terminal of human DMRT1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/409