Anti-DNAJB5 antibody produced in rabbit

Product Name: Anti-DNAJB5 antibody produced in rabbit

Product Type: Chemical

CAS NO: 1404437-62-2JAK inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 39 kDa
NCBI accession no.
NP_001128476
Shipped in: wet ice
species reactivity
rabbit, canine, horse, human, guinea pig, mouse, rat
Storage temp.: −20°C
Application: Anti-DNAJB5 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
DNAJB5 (hsp40) is a molecular chaperone that regulates protein folding and intracellular trafficking. It interacts with Hsp70 and represses the heat shock transcription factor Hsf1 to optimize cellular growth under thermal stress in Saccharomyces pombe. It interacts with HDAC4 and negatively regulates cardiac hypertrophy.
Immunogen:
The immunogen for anti-DNAJB5 antibody: synthetic peptide derected towards the N terminal of human DNAJB5
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/193