Anti-E2F5 antibody produced in rabbit

Product Name: Anti-E2F5 antibody produced in rabbit

Product Type: Chemical

CAS NO: 479-92-5FXR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 38 kDa
NCBI accession no.
NP_001077057
Shipped in: wet ice
species reactivity
human, pig, rabbit, mouse, rat, guinea pig, zebrafish, canine
Storage temp.: −20°C
Application: Anti-E2F5 antibody produced in rabbit is suitable for western blotting at a concentration of 0.4 μg/ml.
Biochem/physiol Actions:
Overexpression of E2F5 has been reported in solid tumors of breast, ovarian, colon and hepatocellular carcinoma. It is a transcription repressor with regulatory roles in cell proliferation, growth and cell cycle progression.
General description: The members of E2F family of transcription factors bind to promoter regions and regulate cell proliferation.
Immunogen:
The immunogen for anti-E2F5 antibody: synthetic peptide derected towards the N terminal of human E2F5
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/855