Product Name: Anti-ERCC8 (AB2) antibody produced in rabbit

Product Type: Chemical

CAS NO: 6106-24-7HSP inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 44 kDa
NCBI accession no.
NP_000073
Shipped in: wet ice
species reactivity
canine, zebrafish, rabbit, guinea pig, human, mouse
Storage temp.: −20°C
Application: Rabbit Anti-ERCC8 can be used for western blot application at a concentration of 0.5μg/ml.
General description: ERCC8 is a WD repeat protein that has been implicated in Cockayne syndrome. Cockayne syndrome is an autosomal recessive disorder that is characterized by mental retardation, photosensitivity, neurodegeneration and premature death.
Rabbit Anti-ERCC8 recognizes canine, zebrafish, chicken, human, and mouse ERCC8.
Immunogen:
The immunogen for anti-ERCC8 antibody: synthetic peptide derected towards the N terminal of human ERCC8
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/330/3/792

Related Post