Anti-ETFB antibody produced in rabbit

Product Name: Anti-ETFB antibody produced in rabbit

Synonym: Anti-Electron-transfer-flavoprotein, β polypeptide; Anti-FP585; Anti-MADD

Product Type: Chemical

CAS NO: 120511-73-1MAPK_ERK Pathway inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 28 kDa
NCBI accession no.
NP_001014763
Shipped in: wet ice
species reactivity
canine, human, guinea pig, bovine, pig, horse, rat, mouse, rabbit
Storage temp.: −20°C
Application: Anti-ETFB antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
ETFB (electron-transfer-flavoprotein, β polypeptide) encodes a flavoprotein that belongs to ETF α-subunit/FixB family and is widely expressed in liver, heart and skeletal muscle. It shuttles electrons to the main mitochondrial respiratory chain through ETF-ubiquinone oxidoreductase (ETF dehydrogenase). It plays a crucial role in mechanoregulation of fibroblast cell number in collagen gel culture. Defect in ETFB gene results in Electron transfer flavoprotein (ETF) deficiency that leads to severe metabolic disorder, glutaric acidemia type II (GAII).
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-ETFB antibody: synthetic peptide derected towards the C terminal of human ETFB
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/47/2/255