Anti-ETS1 antibody produced in rabbit

Product Name: Anti-ETS1 antibody produced in rabbit

Synonym: Anti-v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)

Product Type: Chemical

CAS NO: 218924-25-5GPR120 inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 50 kDa
NCBI accession no.
NP_001137292
Shipped in: wet ice
species reactivity
goat, mouse, rabbit, rat, bovine, human, horse, guinea pig, canine, zebrafish
Storage temp.: −20°C
Application: Anti-ETS1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
The DNA-binding activity of ETS1 requires the phosphorylation at Thr38 by ERK1/2. ETS1 is expressed in a variety of cell types including hematopoietis cells, endothelial cells, epithelial cancer cells and vascular smooth muscle cells. ETS1 promotes cell invasion and angiogenesis as it regulates the transcription of VEGF and MMP genes.
General description: ETS1 belongs to the Ets family of transcription factors that are crucial mediators of extracellular matrix remodeling. The Ets family members are regulators of bone and cartilage development.
Immunogen:
The immunogen for anti-ETS1 antibody: synthetic peptide derected towards the N terminal of human ETS1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/321