Anti-ETS2 antibody produced in rabbit

Product Name: Anti-ETS2 antibody produced in rabbit

Synonym: Anti-v-ets erythroblastosis virus E26 oncogene homolog 2 (avian)

Product Type: Chemical

CAS NO: 95523-13-0IFNAR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 53 kDa
NCBI accession no.
NP_005230
Shipped in: wet ice
species reactivity
rat, guinea pig, human, mouse, sheep, canine, horse, bovine
Storage temp.: −20°C
Application: Anti-ETS2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions:
ETS family members have binding sites for AP-1 and MAPK proteins. ETS2 significantly regulates the skeletal development and differentiation of osteoblasts. Decreased expression of ETS2 results in skeletal abnormalities similar to those observed in humans with Down′s syndrome. Studies show that ETS2 promotes angiogenesis breast cancer progression.
General description: ETS2 belongs to the Ets family of transcription factors that are crucial mediators of extracellular matrix remodeling. The Ets family members are regulators of bone and cartilage development.
Immunogen:
The immunogen for anti-ETS2 antibody: synthetic peptide derected towards the middle region of human ETS2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: FESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/426