Anti-ETV6 antibody produced in rabbit

Product Name: Anti-ETV6 antibody produced in rabbit

Synonym: Anti-Ets variant gene 6 (TEL oncogene); Anti-TEL; Anti-TEL/ABL

Product Type: Chemical

CAS NO: 50-14-6MAPKAPK2 (MK2) inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 53 kDa
NCBI accession no.
NP_001978
Shipped in: wet ice
species reactivity
canine, zebrafish, guinea pig, human, rabbit, bovine, zebrafish, mouse, rat, horse
Storage temp.: −20°C
Application: Anti-ETV6 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
ETV6 belongs to the Ets family of transcription factors and is rearranged in human myeloid and lymphoid leukemias. ETV6 is required for the process of hematopoiesis within bone marrow.
Immunogen:
The immunogen for anti-ETV6 antibody: synthetic peptide derected towards the C terminal of human ETV6
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFR
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/556