Product Name: Anti-EVX1 antibody produced in rabbit

Synonym: Anti-Even-skipped homeobox 1

Product Type: Chemical

CAS NO: 1714146-59-4Chloride Channel inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 42 kDa
NCBI accession no.
NP_001980
species reactivity
rat, guinea pig, canine, human, bovine, mouse, rabbit
Storage temp.: −20°C
Application: Rabbit polyclonal anti-EVX1 antibody is used to tag Even-skipped homeobox 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Even-skipped homeobox 1 in the regulation of embryonic stem cell (ESC) differentiation and embryogenesis, especially within the region of the primitive streak. The antibody is suitable for western blotting at a concentration of 1-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
EVX1 appears just prior to grastrulation in the region of ectoderm containing cells destined to be found in the primitive streak, where it may be involved in dorsoventral specification of mesodermal cell fate. EVX1 is believed to be a postmitotic determinant of V0 interneuron identity. The expression of genes regulated by EVX1 is crucial for the development of zebrafish fin dermoskeleton.
General description: Even-skipped homeobox 1 (EVX1) is a homeobox transcription factor involved in embryonic stem cell differentiation and embryogenesis. EVX1 has been shown to control ESC differentiation at least in part by repressing GOOSECOID expression.
General description: Rabbit polyclonal anti-EVX1 antibody reacts with chicken, human, mouse, rat, canine, bovine, and rabbit Even-skipped homeobox 1 transcription factors.
Immunogen:
The immunogen for anti-EVX1 antibody: synthetic peptide derected towards the N terminal of human EVX1
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/628

Related Post