Anti-FASLG antibody produced in rabbit

Product Name: Anti-FASLG antibody produced in rabbit

Synonym: Anti-Fas ligand (TNF superfamily, member 6)

Product Type: Chemical

CAS NO: 1400591-39-0APC inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 31 kDa
NCBI accession no.
NP_000630
Shipped in: wet ice
species reactivity
bovine, horse, human
Storage temp.: −20°C
Application: Anti-FASLG antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
FAS ligand belongs to the family of TNF receptors. The interaction between Fas and its ligand induces apoptosis and elicits peripheral immune responses. The binding of Fas ligand to its cognate receptor initiates extrinsic apoptotic pathway that involves caspase-8. The abnormal Fas/FasL function correlates to the progression of many malignancies.
Immunogen:
The immunogen for anti-FASLG antibody: synthetic peptide derected towards the middle region of human FASLG
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/777