Product Name: Anti-FAU antibody produced in rabbit

Synonym: Anti-FAU1; Anti-FLJ22986; Anti-Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed; Anti-Fub1; Anti-Fubi; Anti-MNSFbeta; Anti-RPS30

Product Type: Chemical

CAS NO: 608141-41-9PPAR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 14 kDa
NCBI accession no.
NP_001988
Shipped in: wet ice
species reactivity
horse, canine, mouse, rat, zebrafish, guinea pig, rabbit, human, bovine, pig,
Storage temp.: −20°C
Application: Anti-FAU antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
FAU (FBR-MuSV associated ubiquitously expressed gene) gene is the cellular counterpart of the fox sequence present in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). FAU gene is mapped on to chromosome 11 at 11q13 and is ubiquitously expressed. It encodes a fusion protein comprising ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. Fubi belongs to ubiquitin family whereas ribosomal protein S30 is a member of S30E family of ribosomal proteins. S30 is a component of 40S ribosomal subunit and facilitates the antimicrobial activity. FAU gene is a pro-apoptotic regulatory gene that augments basal apoptosis in human T-cell lines and 293T/17 cells.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-FAU antibody: synthetic peptide derected towards the middle region of human FAU
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/48/2/241

Related Post