Product Name: Anti-FKBP8 (AB2) antibody produced in rabbit

Synonym: Anti-FK506 binding protein 8, 38 kDa; Anti-FKBP38

Product Type: Chemical

CAS NO: 330786-25-9HCV inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Mol wt: mol wt 45 kDa
NCBI accession no.
NP_036313
packaging
pkg of 100 μL buffered aqueous solution

pkg of 50 μg lyophilized powder
species reactivity
bovine, rat, horse, zebrafish, guinea pig, canine, human, mouse
Storage temp.: −20°C
Application: Anti-FKBP8 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
FKBP8 gene encodes for FK506 binding protein 8, which is a membrane-anchored, tetratricopeptide repeat (TPR)-containing immunophilin that belongs to peptidylprolyl isomerase family and facilitates the cis/trans interconversion of peptidyl prolyl bonds. It also regulates the late stage of cystic fibrosis transmembrane conductance regulator (CFTR) folding and stability. FKBP38 plays a crucial role in regulating the apoptosis as well as the function of Bcl-2. Overexpression of FKBP38 diminishes the reduction rate of Bcl-2 that leads to increase in intracellular Bcl-2 level and inhibits the apoptotic cell death. Further, FKBP8 directly interact with the flexible loop domain of Bcl-2 that contains the caspase cleavage site and protects Bcl-2 from caspase-dependent degradation.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-FKBP8 antibody: synthetic peptide derected towards the C terminal of human FKBP8
Sequence:
Synthetic peptide located within the following region: AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/356/2/293

Related Post