Anti-FLJ20729 antibody produced in rabbit

Product Name: Anti-FLJ20729 antibody produced in rabbit

Product Type: Chemical

CAS NO: 1831167-98-6DGAT inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 54 kDa
NCBI accession no.
NP_060423
Shipped in: wet ice
species reactivity
guinea pig, horse, human, rabbit, canine, mouse
Storage temp.: −20°C
Application: Rabbit Anti-FLJ20729 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml and for IHC at 4-8 μg/ml.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: FLJ20729 (ZNHIT6) is a zinc finger, HIT-type containing protein.
Rabbit Anti-FLJ20729 antibody recognizes human, canine, chicken, and mouse FLJ20729.
Immunogen:
The immunogen for anti-FLJ20729 antibody: synthetic peptide derected towards the C terminal of human FLJ20729
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVK
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/335/1/256