Product Name: Anti-FOXN1 antibody produced in rabbit

Synonym: Anti-Forkhead box N1

Product Type: Chemical

CAS NO: 1462249-75-7Progesterone Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 69 kDa
NCBI accession no.
NP_003584
species reactivity
bovine, human, rabbit, pig, rat, canine, guinea pig, horse, mouse
Storage temp.: −20°C
Application: Rabbit polyclonal anti-FOXN1 antibody is used to tag Forkhead box N1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Forkhead box N1 in thymocyte generation and maturation and the development of the nude/SCID phenotype. Anti-FOXN1 antibody produced in rabbit is suitable for western blotting at a concentration of 5 microg/ml.
General description: Forkhead box N1 (FOXN1) is a forkhead/winged-helix transcription factor believed to function in the differentiation of the central nervous system and survival of the thymic and skin epithelial cells. FOXN1 supports the generation and maturation of functional thymocytes. Defects in FOXN1 lead to the Nude/SCID phenotype.
General description: Rabbit polyclonal anti-FOXN1 antibody reacts with bovine, human, mouse, rat, and canine Forkhead box N1 transcription factors.
Immunogen:
The immunogen for anti-FOXN1 antibody: synthetic peptide derected towards the N terminal of human FOXN1
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: FVSDGPPERTPSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYP
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/505

Related Post