Anti-FOXO1 (AB1) antibody produced in rabbit

Product Name: Anti-FOXO1 (AB1) antibody produced in rabbit

Synonym: Anti-FKH1; Anti-FKHR; Anti-FOXO1A

Product Type: Chemical

CAS NO: 1454585-06-8GPR40 inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 70 kDa
NCBI accession no.
NP_002006
Shipped in: wet ice
species reactivity
zebrafish, pig, mouse, bovine, canine, human, rat
Storage temp.: −20°C
Application: Anti-FOXO1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
FoxO1 mediates the signaling pathways that are involved in glucose metabolism. It is highly expressed in pancreas, liver, adipose and skeletal muscle tissue. The main role of FoxO1 is the maintenance of energy homeostasis during fasting, glycemic control and regulate the breakdown of carbohydrates. FoxO1 is a critical energy and nutrient regulator and is conserved across species.
General description: The FOXO family of transcription factors mediates the interplay between the PI3K-Akt and TOR signaling. The PI3K-Akt-FoxO signaling axis has direct role in cell proliferation, oxidative stress, tumorigenesis and physiological processes.
Immunogen:
The immunogen for anti-FOXO1 antibody: synthetic peptide derected towards the N terminal of human FOXO1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAA
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/331