Product Name: Anti-GABRD antibody produced in rabbit

Synonym: Anti-γ-Aminobutyric acid (GABA) A receptor, δ; Anti-MGC45284

Product Type: Chemical

CAS NO: 55837-20-2NF-(kappa)B inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 51 kDa
NCBI accession no.
NP_000806
Shipped in: wet ice
species reactivity
human, mouse, bovine, canine, rabbit
Storage temp.: −20°C
Application: Anti-GABRD antibody produced in rabbit is suitable for western blotting at a concentration of 5 μg/ml.
Biochem/physiol Actions:
GABRD is a subunit of GABAA receptor, the main inhibitory receptor in the brain. GABRD receptors in mouse taste buds inhibit the secretion of ATP from receptor cells during taste stimulation and are important for growth and differentiation of taste buds.
Immunogen:
The immunogen for anti-GABRD antibody: synthetic peptide derected towards the N terminal of human GABRD
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/231

Related Post