Product Name: Anti-GCM1 (AB1) antibody produced in rabbit

Synonym: Anti-Glial cells missing homolog 1 (Drosophila)

Product Type: Chemical

CAS NO: 155798-08-6iGluR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 49 kDa
NCBI accession no.
NP_003634
Shipped in: wet ice
species reactivity
human, canine, horse, rabbit
Storage temp.: −20°C
Application: Anti-GCM1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions:
GCM1 controls the differentiation and lineage determination of neuroglia progenitor cells into neurons and glia. Human GCM1 regulates the activity of placental specific CYP19 gene that determines the cell lineage in the syncytiotrophoblast. It arrests the cell cycle of trophoblast stem cells and restricts them to syncytiotrophoblast cells.
Immunogen:
The immunogen for anti-GCM1 antibody: synthetic peptide derected towards the C terminal of human GCM1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/2/663

Related Post