Anti-GDI1 antibody produced in rabbit

Product Name: Anti-GDI1 antibody produced in rabbit

Synonym: Anti-GDP dissociation inhibitor 1

Product Type: Chemical

CAS NO: 1197194-61-8Insulin Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 51 kDa
NCBI accession no.
NP_001484
Shipped in: wet ice
species reactivity
canine, human, rat, mouse, bovine
Storage temp.: −20°C
Application: Anti-GDI2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
GDP dissociation inhibitors regulate the GDP-GTP exchange reaction of GTP-binding protein members of Rab superfamily. They decrease the dissociation rate of GDP from these proteins and regulate the vesicular trafficking between the cellular organelles.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-GDI1 antibody: synthetic peptide derected towards the C terminal of human GDI1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/387