Product Name: Anti-GJA1 antibody produced in rabbit

Synonym: Anti-Gap junction protein, α 1, 43 kDa

Product Type: Chemical

CAS NO: 1831110-54-3ATGL inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 42 kDa
NCBI accession no.
NP_000156
Shipped in: wet ice
species reactivity
bovine, mouse, rabbit, rabbit, guinea pig, horse, human, canine, sheep, pig, rat
Storage temp.: −20°C
Biochem/physiol Actions:
GJA1 also known as connexin 43 is a gap junction protein that belongs to the connexin family. It is a component of the gap junctions between cells that facilitate the diffusion of low molecular weight materials and ions from cell to cell. Missense mutations in GJA1 gene have been linked to a rare skeletal disorder known as craniometaphyseal dysplasia. GJA1 is crucial for synchronized contractions in the heart.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-GJA1 antibody: synthetic peptide derected towards the N terminal of human GJA1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/338/2/421

Related Post