Product Name: Anti-GLIS2 antibody produced in rabbit

Synonym: Anti-GLIS family zinc finger 2

Product Type: Chemical

CAS NO: 1443460-91-0Others inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 56 kDa
NCBI accession no.
NP_115964
Shipped in: wet ice
species reactivity
canine, rabbit, human, rat, mouse, guinea pig, horse
Storage temp.: −20°C
Application: Anti-GLIS2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions:
GLIS family zinc finger 2 (GLIS2), a Krüppel-like zinc finger protein family member with transactivation and repressor functions, is involved in kidney development, the maintenance of normal renal function and neurogenesis. Glis2 interacts with β-catenin and may function as a negative modulator of β-catenin/TCF-mediated transcription. Defective GLIS2 has been linked to the development of nephronophthisis.
Immunogen:
The immunogen for anti-GLIS2 antibody: synthetic peptide derected towards the N terminal of human GLIS2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/479

Related Post